GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
£0.00
Frosted Pixie Sample Card
Frosted Pixie Sample Card

Frosted Pixie Sample Card

Units in Stock 0
Notify me when product is back in stock
£1.50 inc. tax

Similar in style and identity to this famous designer fragrance. A vibrant sweet fruity accord with notes of bubblegum, banana, pear drops, musk and vanilla with sweet candy floss.

! Allergy information: ALPHA- ISOMETHYL IONONE
Contains: PENTADECALACTONE, TRANS-ROSE KETONE-1

Price is for two sample cards.


*Please note that as each item is handmade, there may be slight differences in colour and appearance. Design will be sent at random.

Product Code: 010920215
weight: 24 g
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Customer Reviews

No Reviews Posted Yet - be the first!

write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i