GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
£0.00
Snap Cards
Snap Cards
Bite Me Sample Card
Bite Me Sample Card
£1.50
Blonde Moment Sample Card
Blonde Moment Sample Card
£1.50
Blueberry Vanilla Sample Card
Blueberry Vanilla Sample Card
£1.50
Frosted Pixie Sample Card
Frosted Pixie Sample Card
£1.50
Frosted Plum Sample Card
Frosted Plum Sample Card
£1.50
Melon Madness Sample Card
Melon Madness Sample Card
£1.50
Parma Violet Sample Card
Parma Violet Sample Card
£1.50
Passionfruit Martini Sample Card
Passionfruit Martini Sample Card
£1.50
Pinky Sands Sample Card
Pinky Sands Sample Card
£1.50
Rhubarb & Custard Sample Card
Rhubarb & Custard Sample Card
£1.50
Twisted Mermaid Sample Card
Twisted Mermaid Sample Card
£1.50
Unicorn Sparkle Sample Card
Unicorn Sparkle Sample Card
£1.50
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i